Lineage for d3ddof_ (3ddo F:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1173024Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1173040Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1173041Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1173372Protein Uridine phosphorylase [53176] (2 species)
  7. 1173474Species Salmonella typhimurium [TaxId:90371] [117656] (23 PDB entries)
    Uniprot P0A1F6
  8. 1173480Domain d3ddof_: 3ddo F: [173842]
    automated match to d1ryza_
    complexed with po4

Details for d3ddof_

PDB Entry: 3ddo (more details), 1.5 Å

PDB Description: X-RAY Structure of the Uridine Phosphorylase from Salmonella Typhimurium in Complex with by Phosphate Ion at 1.5A Resolution
PDB Compounds: (F:) Uridine phosphorylase

SCOPe Domain Sequences for d3ddof_:

Sequence, based on SEQRES records: (download)

>d3ddof_ c.56.2.1 (F:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Sequence, based on observed residues (ATOM records): (download)

>d3ddof_ c.56.2.1 (F:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnashavkivveaar
rll

SCOPe Domain Coordinates for d3ddof_:

Click to download the PDB-style file with coordinates for d3ddof_.
(The format of our PDB-style files is described here.)

Timeline for d3ddof_: