Lineage for d1fbva1 (1fbv A:178-263)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47807Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)
  6. 47833Protein Cbl [47561] (1 species)
  7. 47834Species Human (Homo sapiens) [TaxId:9606] [47562] (3 PDB entries)
  8. 47839Domain d1fbva1: 1fbv A:178-263 [17384]
    Other proteins in same PDB: d1fbva2, d1fbva3, d1fbva4, d1fbvc_

Details for d1fbva1

PDB Entry: 1fbv (more details), 2.9 Å

PDB Description: structure of a cbl-ubch7 complex: ring domain function in ubiquitin- protein ligases

SCOP Domain Sequences for d1fbva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbva1 a.39.1.7 (A:178-263) Cbl {Human (Homo sapiens)}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav

SCOP Domain Coordinates for d1fbva1:

Click to download the PDB-style file with coordinates for d1fbva1.
(The format of our PDB-style files is described here.)

Timeline for d1fbva1: