Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (91 species) not a true protein |
Species Glomerella cingulata [TaxId:5457] [188664] (3 PDB entries) |
Domain d3dd5h_: 3dd5 H: [173832] automated match to d1cuwa_ complexed with dep |
PDB Entry: 3dd5 (more details), 2.6 Å
SCOPe Domain Sequences for d3dd5h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dd5h_ c.69.1.0 (H:) automated matches {Glomerella cingulata [TaxId: 5457]} sstrneletgsssacpkviyifarastepgnmgisagpivadaleriygandvwvqgvgg pyladlasnflpdgtssaainearrlftlantkcpnaaivsggysqgtavmagsisglst tiknqikgvvlfgytknlqnlgripnfetsktevycdiadavcygtlfilpahflyqtda avaaprflqarig
Timeline for d3dd5h_: