![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins) |
![]() | Protein Cbl [47561] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47562] (12 PDB entries) |
![]() | Domain d1b47c1: 1b47 C:178-263 [17383] Other proteins in same PDB: d1b47a2, d1b47a3, d1b47b2, d1b47b3, d1b47c2, d1b47c3 complexed with ca |
PDB Entry: 1b47 (more details), 2.2 Å
SCOPe Domain Sequences for d1b47c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b47c1 a.39.1.7 (C:178-263) Cbl {Human (Homo sapiens) [TaxId: 9606]} tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis vfefdiftrlfqpwssllrnwnslav
Timeline for d1b47c1: