SCOPe 2.01: Domain d3dcqa_: 3dcq A:

Lineage for d3dcqa_ (3dcq A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key

4. Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families)

5. Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)

6. Protein automated matches [190094] (2 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [186815] (12 PDB entries)

8. Domain d3dcqa_: 3dcq A: [173817]
   automated match to d1gzta_
   complexed with 2g0, ca

Details for d3dcqa_

PDB Entry: 3dcq, 1.8 Å

PDB Description: lecb (pa-lii) in complex with the synthetic ligand 2g0

PDB Compounds: (A:) Fucose-binding lectin PA-IIL

SCOPe Domain Sequences for d3dcqa_:

Sequence; same for both SEQRES and ATOM records:

>d3dcqa_ b.115.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

Timeline for d3dcqa_:

• d3dcqa_ is new in SCOPe 2.01-stable
  
• d3dcqa_ appears in SCOPe 2.02
  
• d3dcqa_ appears in the current release, SCOPe 2.08