Lineage for d3dcna1 (3dcn A:31-224)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2152904Species Glomerella cingulata [TaxId:5457] [188664] (3 PDB entries)
  8. 2152905Domain d3dcna1: 3dcn A:31-224 [173816]
    Other proteins in same PDB: d3dcna2
    automated match to d1cuwa_

Details for d3dcna1

PDB Entry: 3dcn (more details), 1.9 Å

PDB Description: Glomerella cingulata apo cutinase
PDB Compounds: (A:) cutinase

SCOPe Domain Sequences for d3dcna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dcna1 c.69.1.0 (A:31-224) automated matches {Glomerella cingulata [TaxId: 5457]}
qsstrneletgsssacpkviyifarastepgnmgisagpivadaleriygandvwvqgvg
gpyladlasnflpdgtssaainearrlftlantkcpnaaivsggysqgtavmagsisgls
ttiknqikgvvlfgytknlqnlgripnfetsktevycdiadavcygtlfilpahflyqtd
aavaaprflqarig

SCOPe Domain Coordinates for d3dcna1:

Click to download the PDB-style file with coordinates for d3dcna1.
(The format of our PDB-style files is described here.)

Timeline for d3dcna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dcna2