Lineage for d3dcna_ (3dcn A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871203Species Glomerella cingulata [TaxId:5457] [188664] (3 PDB entries)
  8. 1871204Domain d3dcna_: 3dcn A: [173816]
    automated match to d1cuwa_

Details for d3dcna_

PDB Entry: 3dcn (more details), 1.9 Å

PDB Description: Glomerella cingulata apo cutinase
PDB Compounds: (A:) cutinase

SCOPe Domain Sequences for d3dcna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dcna_ c.69.1.0 (A:) automated matches {Glomerella cingulata [TaxId: 5457]}
dpqsstrneletgsssacpkviyifarastepgnmgisagpivadaleriygandvwvqg
vggpyladlasnflpdgtssaainearrlftlantkcpnaaivsggysqgtavmagsisg
lsttiknqikgvvlfgytknlqnlgripnfetsktevycdiadavcygtlfilpahflyq
tdaavaaprflqarig

SCOPe Domain Coordinates for d3dcna_:

Click to download the PDB-style file with coordinates for d3dcna_.
(The format of our PDB-style files is described here.)

Timeline for d3dcna_: