Lineage for d3dbjg_ (3dbj G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 2689364Species Thermosynechococcus vulcanus [TaxId:32053] [188656] (1 PDB entry)
  8. 2689371Domain d3dbjg_: 3dbj G: [173804]
    automated match to d1kn1a_
    complexed with cyc

Details for d3dbjg_

PDB Entry: 3dbj (more details), 2.9 Å

PDB Description: Allophycocyanin from Thermosynechococcus vulcanus
PDB Compounds: (G:) allophycocyanin

SCOPe Domain Sequences for d3dbjg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbjg_ a.1.1.3 (G:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
svvtksivnadaearylspgeldriknfvstgerrlriaqtltenrerivkqagdqlfqk
rpdvvspggnaygeemtatclrdldyylrlvtygivagdvtpieeiglvgvremynslgt
pipavaegiramknvacsllsaedaaeagsyfdfvigamq

SCOPe Domain Coordinates for d3dbjg_:

Click to download the PDB-style file with coordinates for d3dbjg_.
(The format of our PDB-style files is described here.)

Timeline for d3dbjg_: