| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore |
| Protein automated matches [190531] (6 species) not a true protein |
| Species Thermosynechococcus vulcanus [TaxId:32053] [188656] (1 PDB entry) |
| Domain d3dbjf_: 3dbj F: [173803] automated match to d1b33b_ complexed with cyc |
PDB Entry: 3dbj (more details), 2.9 Å
SCOPe Domain Sequences for d3dbjf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dbjf_ a.1.1.3 (F:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
mqdaitavinasdvqgkyldtaameklkayfatgelrvraasvisanaanivkeavaksl
lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
vpiaatvqaiqamkevtaslvgadagkemgiyfdyicsgls
Timeline for d3dbjf_: