Lineage for d2cbla1 (2cbl A:178-263)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins) 
Protein Cbl [47561] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47562] (3 PDB entries) 
Domain d2cbla1: 2cbl A:178-263 [17380]
Other proteins in same PDB: d2cbla2, d2cbla3
Details for d2cbla1
PDB Entry: 2cbl (more details), 2.1 Å
PDB Description: n-terminal domain of cbl in complex with its binding site on zap-70
SCOP Domain Sequences for d2cbla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cbla1 a.39.1.7 (A:178-263) Cbl {Human (Homo sapiens)}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav
SCOP Domain Coordinates for d2cbla1:
Click to download the PDB-style file with coordinates for d2cbla1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cbla1:
View in 3D
