![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
![]() | Protein automated matches [190531] (8 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [188656] (1 PDB entry) |
![]() | Domain d3dbjb_: 3dbj B: [173799] automated match to d1b33b_ complexed with cyc |
PDB Entry: 3dbj (more details), 2.9 Å
SCOPe Domain Sequences for d3dbjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dbjb_ a.1.1.3 (B:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} mqdaitavinasdvqgkyldtaameklkayfatgelrvraasvisanaanivkeavaksl lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg vpiaatvqaiqamkevtaslvgadagkemgiyfdyicsgls
Timeline for d3dbjb_: