Lineage for d1eg4a2 (1eg4 A:210-306)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1087625Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1088531Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)
  6. 1088557Protein Dystrophin [47559] (1 species)
    probably lost calcium-binding function; contains extra helices in each domain
  7. 1088558Species Human (Homo sapiens) [TaxId:9606] [47560] (2 PDB entries)
  8. 1088562Domain d1eg4a2: 1eg4 A:210-306 [17379]
    Other proteins in same PDB: d1eg4a3

Details for d1eg4a2

PDB Entry: 1eg4 (more details), 2 Å

PDB Description: structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
PDB Compounds: (A:) dystrophin

SCOPe Domain Sequences for d1eg4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg4a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]}
hledkyrylfkqvasstgfcdqrrlglllhdsiqiprqlgevasfggsniepsvrscfqf
annkpeieaalfldwmrlepqsmvwlpvlhrvaaaet

SCOPe Domain Coordinates for d1eg4a2:

Click to download the PDB-style file with coordinates for d1eg4a2.
(The format of our PDB-style files is described here.)

Timeline for d1eg4a2: