Lineage for d1eg4a2 (1eg4 A:210-306)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47807Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)
  6. 47840Protein Dystrophin [47559] (1 species)
  7. 47841Species Human (Homo sapiens) [TaxId:9606] [47560] (2 PDB entries)
  8. 47845Domain d1eg4a2: 1eg4 A:210-306 [17379]
    Other proteins in same PDB: d1eg4a3

Details for d1eg4a2

PDB Entry: 1eg4 (more details), 2 Å

PDB Description: structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide

SCOP Domain Sequences for d1eg4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg4a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens)}
hledkyrylfkqvasstgfcdqrrlglllhdsiqiprqlgevasfggsniepsvrscfqf
annkpeieaalfldwmrlepqsmvwlpvlhrvaaaet

SCOP Domain Coordinates for d1eg4a2:

Click to download the PDB-style file with coordinates for d1eg4a2.
(The format of our PDB-style files is described here.)

Timeline for d1eg4a2: