Lineage for d3daqc_ (3daq C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1343361Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1343362Protein automated matches [190115] (51 species)
    not a true protein
  7. 1343681Species Staphylococcus aureus [TaxId:282458] [188514] (1 PDB entry)
  8. 1343684Domain d3daqc_: 3daq C: [173789]
    automated match to d1o5ka_
    complexed with cl, gol

Details for d3daqc_

PDB Entry: 3daq (more details), 1.45 Å

PDB Description: Crystal structure of dihydrodipicolinate synthase from methicillin-resistant Staphylococcus aureus
PDB Compounds: (C:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3daqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3daqc_ c.1.10.0 (C:) automated matches {Staphylococcus aureus [TaxId: 282458]}
thlfegvgvalttpftnnkvnlealkahvnfllennaqaiivngttaesptlttdekeli
lktvidlvdkrvpviagtgtndteksiqasiqakalgadaimlitpyynktnqrglvkhf
eaiadavklpvvlynvpsrtnmtiepetveilsqhpyivalkdatndfeyleevkkridt
nsfalysgnddnvveyyqrggqgvisvianvipkefqalydaqqsgldiqdqfkpigtll
salsvdinpipikaltsylgfgnyelrlplvsledtdtkvlreaydtfkage

SCOPe Domain Coordinates for d3daqc_:

Click to download the PDB-style file with coordinates for d3daqc_.
(The format of our PDB-style files is described here.)

Timeline for d3daqc_: