| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (51 species) not a true protein |
| Species Staphylococcus aureus [TaxId:282458] [188514] (1 PDB entry) |
| Domain d3daqc_: 3daq C: [173789] automated match to d1o5ka_ complexed with cl, gol |
PDB Entry: 3daq (more details), 1.45 Å
SCOPe Domain Sequences for d3daqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3daqc_ c.1.10.0 (C:) automated matches {Staphylococcus aureus [TaxId: 282458]}
thlfegvgvalttpftnnkvnlealkahvnfllennaqaiivngttaesptlttdekeli
lktvidlvdkrvpviagtgtndteksiqasiqakalgadaimlitpyynktnqrglvkhf
eaiadavklpvvlynvpsrtnmtiepetveilsqhpyivalkdatndfeyleevkkridt
nsfalysgnddnvveyyqrggqgvisvianvipkefqalydaqqsgldiqdqfkpigtll
salsvdinpipikaltsylgfgnyelrlplvsledtdtkvlreaydtfkage
Timeline for d3daqc_: