SCOPe 2.08: Domain d3dabg1: 3dab G:23-109

Lineage for d3dabg1 (3dab G:23-109)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.0: automated matches [191556] (1 protein)
   not a true family

6. Protein automated matches [190960] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188578] (22 PDB entries)

8. Domain d3dabg1: 3dab G:23-109 [173785]
   Other proteins in same PDB: d3daba2, d3dabc2, d3dabe2, d3dabg2
   automated match to d1ycqa_

Details for d3dabg1

PDB Entry: 3dab, 1.9 Å

PDB Description: structure of the human mdmx protein bound to the p53 tumor suppressor transactivation domain

PDB Compounds: (G:) mdm4 protein

SCOPe Domain Sequences for d3dabg1:

Sequence; same for both SEQRES and ATOM records:

>d3dabg1 a.42.1.0 (G:23-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllg
ellgrqsfsvkdpsplydmlrknlvtl

Timeline for d3dabg1:

• d3dabg1 first appeared in SCOPe 2.01, called d3dabg_
  
• d3dabg1 appears in SCOPe 2.07