Lineage for d3dabg1 (3dab G:23-109)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712363Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2712364Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2712548Family a.42.1.0: automated matches [191556] (1 protein)
    not a true family
  6. 2712549Protein automated matches [190960] (1 species)
    not a true protein
  7. 2712550Species Human (Homo sapiens) [TaxId:9606] [188578] (22 PDB entries)
  8. 2712573Domain d3dabg1: 3dab G:23-109 [173785]
    Other proteins in same PDB: d3daba2, d3dabc2, d3dabe2, d3dabg2
    automated match to d1ycqa_

Details for d3dabg1

PDB Entry: 3dab (more details), 1.9 Å

PDB Description: structure of the human mdmx protein bound to the p53 tumor suppressor transactivation domain
PDB Compounds: (G:) mdm4 protein

SCOPe Domain Sequences for d3dabg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dabg1 a.42.1.0 (G:23-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllg
ellgrqsfsvkdpsplydmlrknlvtl

SCOPe Domain Coordinates for d3dabg1:

Click to download the PDB-style file with coordinates for d3dabg1.
(The format of our PDB-style files is described here.)

Timeline for d3dabg1: