SCOPe 2.05: Domain d3da7h_: 3da7 H:

Lineage for d3da7h_ (3da7 H:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.1: Barstar-related [52038] (1 family)
   automatically mapped to Pfam PF01337

5. Family c.9.1.1: Barstar-related [52039] (3 proteins)

6. Protein automated matches [190697] (2 species)
   not a true protein

7. Species Bacillus amyloliquefaciens [TaxId:1390] [188456] (5 PDB entries)

8. Domain d3da7h_: 3da7 H: [173781]
   automated match to d1b3sd_
   mutant

Details for d3da7h_

PDB Entry: 3da7, 2.25 Å

PDB Description: a conformationally strained, circular permutant of barnase

PDB Compounds: (H:) barstar

SCOPe Domain Sequences for d3da7h_:

Sequence; same for both SEQRES and ATOM records:

>d3da7h_ c.9.1.1 (H:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
qltengaesvlqvfreakaegcditiils

Timeline for d3da7h_:

• d3da7h_ first appeared in SCOPe 2.01
  
• d3da7h_ appears in SCOPe 2.04
  
• d3da7h_ appears in SCOPe 2.06
  
• d3da7h_ appears in the current release, SCOPe 2.08