Lineage for d3da7h_ (3da7 H:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980177Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 980178Superfamily c.9.1: Barstar-related [52038] (1 family) (S)
  5. 980179Family c.9.1.1: Barstar-related [52039] (3 proteins)
  6. 980218Protein automated matches [190697] (1 species)
    not a true protein
  7. 980219Species Bacillus amyloliquefaciens [TaxId:1390] [188456] (5 PDB entries)
  8. 980231Domain d3da7h_: 3da7 H: [173781]
    automated match to d1b3sd_
    mutant

Details for d3da7h_

PDB Entry: 3da7 (more details), 2.25 Å

PDB Description: a conformationally strained, circular permutant of barnase
PDB Compounds: (H:) barstar

SCOPe Domain Sequences for d3da7h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3da7h_ c.9.1.1 (H:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
qltengaesvlqvfreakaegcditiils

SCOPe Domain Coordinates for d3da7h_:

Click to download the PDB-style file with coordinates for d3da7h_.
(The format of our PDB-style files is described here.)

Timeline for d3da7h_: