SCOP 1.69: Domain d1eg4a1: 1eg4 A:85-209

Lineage for d1eg4a1 (1eg4 A:85-209)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (5 proteins)

6. Protein Dystrophin [47559] (1 species)
   probably lost calcium-binding function; contains extra helices in each domain

7. Species Human (Homo sapiens) [TaxId:9606] [47560] (2 PDB entries)

8. Domain d1eg4a1: 1eg4 A:85-209 [17378]
   Other proteins in same PDB: d1eg4a3

Details for d1eg4a1

PDB Entry: 1eg4, 2 Å

PDB Description: structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide

SCOP Domain Sequences for d1eg4a1:

Sequence; same for both SEQRES and ATOM records:

>d1eg4a1 a.39.1.7 (A:85-209) Dystrophin {Human (Homo sapiens)}
hpkmtelyqsladlnnvrfsayrtamklrrlqkalcldllslsaacdaldqhnlkqndqp
mdilqiinclttiydrleqehnnlvnvplcvdmclnwllnvydtgrtgrirvlsfktgii
slcka

Timeline for d1eg4a1:

• d1eg4a1 first appeared (with stable ids) in SCOP 1.55
  
• d1eg4a1 appears in SCOP 1.67
  
• d1eg4a1 appears in SCOP 1.71
  
• d1eg4a1 appears in the current release, SCOPe 2.08