Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
Superfamily c.9.1: Barstar-related [52038] (1 family) automatically mapped to Pfam PF01337 |
Family c.9.1.1: Barstar-related [52039] (3 proteins) |
Protein automated matches [190697] (2 species) not a true protein |
Species Bacillus amyloliquefaciens [TaxId:1390] [188456] (5 PDB entries) |
Domain d3da7c_: 3da7 C: [173778] automated match to d1b3sd_ mutant |
PDB Entry: 3da7 (more details), 2.25 Å
SCOPe Domain Sequences for d3da7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3da7c_ c.9.1.1 (C:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]} mkkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqs kqltengaesvlqvfreakaegcditiils
Timeline for d3da7c_: