SCOPe 2.03: Domain d3da2b_: 3da2 B:

Lineage for d3da2b_ (3da2 B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187805] (14 PDB entries)

8. Domain d3da2b_: 3da2 B: [173776]
   automated match to d1bzma_
   complexed with 4md, cl, zn

Details for d3da2b_

PDB Entry: 3da2, 2.05 Å

PDB Description: x-ray structure of human carbonic anhydrase 13 in complex with inhibitor

PDB Compounds: (B:) Carbonic anhydrase 13

SCOPe Domain Sequences for d3da2b_:

Sequence; same for both SEQRES and ATOM records:

>d3da2b_ b.74.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg
hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw
nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls
llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs
nhrppqplkgrkvrasf

Timeline for d3da2b_:

• d3da2b_ first appeared in SCOPe 2.01
  
• d3da2b_ appears in SCOPe 2.02
  
• d3da2b_ appears in SCOPe 2.04
  
• d3da2b_ appears in the current release, SCOPe 2.08