Class b: All beta proteins [48724] (174 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins) automatically mapped to Pfam PF00194 |
Protein automated matches [190681] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187805] (14 PDB entries) |
Domain d3da2b_: 3da2 B: [173776] automated match to d1bzma_ complexed with 4md, cl, zn |
PDB Entry: 3da2 (more details), 2.05 Å
SCOPe Domain Sequences for d3da2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3da2b_ b.74.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs nhrppqplkgrkvrasf
Timeline for d3da2b_: