SCOPe 2.08: Domain d3da2a1: 3da2 A:1-261

Lineage for d3da2a1 (3da2 A:1-261)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187805] (57 PDB entries)

8. Domain d3da2a1: 3da2 A:1-261 [173775]
   Other proteins in same PDB: d3da2a2
   automated match to d1bzma_
   complexed with 4md, cl, zn

Details for d3da2a1

PDB Entry: 3da2, 2.05 Å

PDB Description: x-ray structure of human carbonic anhydrase 13 in complex with inhibitor

PDB Compounds: (A:) Carbonic anhydrase 13

SCOPe Domain Sequences for d3da2a1:

Sequence; same for both SEQRES and ATOM records:

>d3da2a1 b.74.1.1 (A:1-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msrlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakii
snsghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelh
vvhwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnf
dllsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaa
flvsnhrppqplkgrkvrasf

Timeline for d3da2a1:

• d3da2a1 first appeared in SCOPe 2.01, called d3da2a_
  
• d3da2a1 appears in SCOPe 2.07