SCOPe 2.05: Domain d3d97a_: 3d97 A:

Lineage for d3d97a_ (3d97 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)

7. Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (34 PDB entries)

8. Domain d3d97a_: 3d97 A: [173769]
   automated match to d1bm5a_
   complexed with b3p, na; mutant

Details for d3d97a_

PDB Entry: 3d97, 1.5 Å

PDB Description: crystal structure of the r132k:r111l:l121e mutant of apo-cellular retinoic acid binding protein type ii at 1.50 angstroms resolution

PDB Compounds: (A:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d3d97a_:

Sequence; same for both SEQRES and ATOM records:

>d3d97a_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
etmtaddvvctkvyvre

Timeline for d3d97a_:

• d3d97a_ first appeared in SCOPe 2.01
  
• d3d97a_ appears in SCOPe 2.04
  
• d3d97a_ appears in SCOPe 2.06
  
• d3d97a_ appears in the current release, SCOPe 2.08