Lineage for d3d96a_ (3d96 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1324198Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1324199Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1324658Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 1324706Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 1324713Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (30 PDB entries)
  8. 1324735Domain d3d96a_: 3d96 A: [173767]
    automated match to d1blra_
    complexed with act; mutant

Details for d3d96a_

PDB Entry: 3d96 (more details), 1.71 Å

PDB Description: crystal structure of the r132k:y134f mutant of apo-cellular retinoic acid binding protein type ii at 1.71 angstroms resolution
PDB Compounds: (A:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d3d96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d96a_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
ltmtaddvvctkvfvre

SCOPe Domain Coordinates for d3d96a_:

Click to download the PDB-style file with coordinates for d3d96a_.
(The format of our PDB-style files is described here.)

Timeline for d3d96a_: