Lineage for d1eg3a1 (1eg3 A:85-209)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711389Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)
  6. 2711421Protein Dystrophin [47559] (1 species)
    probably lost calcium-binding function; contains extra helices in each domain
  7. 2711422Species Human (Homo sapiens) [TaxId:9606] [47560] (2 PDB entries)
  8. 2711423Domain d1eg3a1: 1eg3 A:85-209 [17376]
    Other proteins in same PDB: d1eg3a3

Details for d1eg3a1

PDB Entry: 1eg3 (more details), 2 Å

PDB Description: structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
PDB Compounds: (A:) dystrophin

SCOPe Domain Sequences for d1eg3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg3a1 a.39.1.7 (A:85-209) Dystrophin {Human (Homo sapiens) [TaxId: 9606]}
hpkmtelyqsladlnnvrfsayrtamklrrlqkalcldllslsaacdaldqhnlkqndqp
mdilqiinclttiydrleqehnnlvnvplcvdmclnwllnvydtgrtgrirvlsfktgii
slcka

SCOPe Domain Coordinates for d1eg3a1:

Click to download the PDB-style file with coordinates for d1eg3a1.
(The format of our PDB-style files is described here.)

Timeline for d1eg3a1: