SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3d8ya_ (3d8y A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2155703Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2155704Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2155705Family d.5.1.1: Ribonuclease A-like [54077] (9 protein domains)
  6. 2156099Protein automated matches [190061] (7 species)
    not a true protein
  7. 2156102Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)
  8. 2156196Domain d3d8ya_: 3d8y A: [173756]
    automated match to d1a2wa_
    complexed with flc, t3s

Details for d3d8ya_

PDB Entry: 3d8y (more details), 1.72 Å

PDB Description: RNase A- 5'-Deoxy-5'-N-piperidinothymidine complex
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d3d8ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d8ya_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d3d8ya_:

Click to download the PDB-style file with coordinates for d3d8ya_.
(The format of our PDB-style files is described here.)

Timeline for d3d8ya_: