Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) |
Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) |
Protein automated matches [190196] (7 species) not a true protein |
Species Cryptosporidium parvum [TaxId:353152] [188494] (1 PDB entry) |
Domain d3d8ha_: 3d8h A: [173753] Other proteins in same PDB: d3d8hb2 automated match to d1xq9a_ |
PDB Entry: 3d8h (more details), 2.01 Å
SCOPe Domain Sequences for d3d8ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d8ha_ c.60.1.1 (A:) automated matches {Cryptosporidium parvum [TaxId: 353152]} tykltlirhgesewnkenrftgwtdvslseqgvseaieagrmllekgfkfdvvytsvlkr aimttwtvlkelgnincpiinhwrlnerhygalqglnksetaskfgedqvkiwrrsfdvp ppvleksdprwpgneliykgicpsclptteclkdtvervkpyfedviapsimsgksvlvs ahgnslrallyllegmtpeqilevniptacplvlelddylkvtkkyyli
Timeline for d3d8ha_: