Lineage for d3d8ga_ (3d8g A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1123682Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 1123683Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 1123859Protein automated matches [190761] (2 species)
    not a true protein
  7. 1123906Species Staphylococcus aureus [TaxId:196620] [188728] (1 PDB entry)
  8. 1123907Domain d3d8ga_: 3d8g A: [173752]
    automated match to d1joka_
    complexed with ca, thp

Details for d3d8ga_

PDB Entry: 3d8g (more details), 1.99 Å

PDB Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS I72R at cryogenic temperature
PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d3d8ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d8ga_ b.40.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakkr
evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniwse

SCOPe Domain Coordinates for d3d8ga_:

Click to download the PDB-style file with coordinates for d3d8ga_.
(The format of our PDB-style files is described here.)

Timeline for d3d8ga_: