SCOPe 2.08: Domain d3d8ca1: 3d8c A:11-349

Lineage for d3d8ca1 (3d8c A:11-349)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (1 protein)

6. Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82196] (38 PDB entries)

8. Domain d3d8ca1: 3d8c A:11-349 [173751]
   Other proteins in same PDB: d3d8ca2
   automated match to d1iz3a_
   complexed with akg, gol, so4, zn; mutant

Details for d3d8ca1

PDB Entry: 3d8c, 2.1 Å

PDB Description: factor inhibiting hif-1 alpha d201g mutant in complex with zn(ii), alpha-ketoglutarate and hif-1 alpha 19mer

PDB Compounds: (A:) hypoxia-inducible factor 1 alpha inhibitor

SCOPe Domain Sequences for d3d8ca1:

Sequence; same for both SEQRES and ATOM records:

>d3d8ca1 b.82.2.6 (A:11-349) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
sgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlv
ypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefve
klqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnlllig
megnvtpahygeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdye
rfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieypl
kahqkvaimrniekmlgealgnpqevgpllntmikgryn

Timeline for d3d8ca1:

• d3d8ca1 first appeared in SCOPe 2.01, called d3d8ca_
  
• d3d8ca1 appears in SCOPe 2.07