Lineage for d3d84x_ (3d84 X:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2510890Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2511215Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2511360Species Mouse (Mus musculus) [TaxId:10090] [187727] (6 PDB entries)
  8. 2511364Domain d3d84x_: 3d84 X: [173750]
    automated match to d1drfa_
    complexed with gol, ndp

Details for d3d84x_

PDB Entry: 3d84 (more details), 1.9 Å

PDB Description: structural analysis of a holo enzyme complex of mouse dihydrofolate reductase with nadph and a ternary complex with the potent and selective inhibitor 2.4-diamino-6-(-2'-hydroxydibenz[b,f]azepin-5- yl)methylpteridine
PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d3d84x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d84x_ c.71.1.1 (X:) Dihydrofolate reductases, eukaryotic type {Mouse (Mus musculus) [TaxId: 10090]}
vrplncivavsqnmgigkngdlpwpplrnefkyfqrmtttssvegkqnlvimgrktwfsi
peknrplkdrinivlsrelkepprgahflakslddalrlieqpelaskvdmvwivggssv
yqeamnqpghlrlfvtrimqefesdtffpeidlgkykllpeypgvlsevqeekgikykfe
vyekkd

SCOPe Domain Coordinates for d3d84x_:

Click to download the PDB-style file with coordinates for d3d84x_.
(The format of our PDB-style files is described here.)

Timeline for d3d84x_: