![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
![]() | Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187727] (6 PDB entries) |
![]() | Domain d3d84x_: 3d84 X: [173750] automated match to d1drfa_ complexed with gol, ndp |
PDB Entry: 3d84 (more details), 1.9 Å
SCOPe Domain Sequences for d3d84x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d84x_ c.71.1.1 (X:) Dihydrofolate reductases, eukaryotic type {Mouse (Mus musculus) [TaxId: 10090]} vrplncivavsqnmgigkngdlpwpplrnefkyfqrmtttssvegkqnlvimgrktwfsi peknrplkdrinivlsrelkepprgahflakslddalrlieqpelaskvdmvwivggssv yqeamnqpghlrlfvtrimqefesdtffpeidlgkykllpeypgvlsevqeekgikykfe vyekkd
Timeline for d3d84x_: