SCOPe 2.05: Domain d3d84x_: 3d84 X:

Lineage for d3d84x_ (3d84 X:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [187727] (6 PDB entries)

8. Domain d3d84x_: 3d84 X: [173750]
   automated match to d1drfa_
   complexed with gol, ndp

Details for d3d84x_

PDB Entry: 3d84, 1.9 Å

PDB Description: structural analysis of a holo enzyme complex of mouse dihydrofolate reductase with nadph and a ternary complex with the potent and selective inhibitor 2.4-diamino-6-(-2'-hydroxydibenz[b,f]azepin-5- yl)methylpteridine

PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d3d84x_:

Sequence; same for both SEQRES and ATOM records:

>d3d84x_ c.71.1.1 (X:) Dihydrofolate reductases, eukaryotic type {Mouse (Mus musculus) [TaxId: 10090]}
vrplncivavsqnmgigkngdlpwpplrnefkyfqrmtttssvegkqnlvimgrktwfsi
peknrplkdrinivlsrelkepprgahflakslddalrlieqpelaskvdmvwivggssv
yqeamnqpghlrlfvtrimqefesdtffpeidlgkykllpeypgvlsevqeekgikykfe
vyekkd

Timeline for d3d84x_:

• d3d84x_ first appeared in SCOPe 2.01
  
• d3d84x_ appears in SCOPe 2.04
  
• d3d84x_ appears in SCOPe 2.06
  
• d3d84x_ appears in the current release, SCOPe 2.08