Lineage for d1df0a1 (1df0 A:515-700)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152429Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 152430Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 152779Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)
  6. 152786Protein Calpain large subunit, C-terminal domain (domain IV) [47556] (2 species)
  7. 152790Species Rat (Rattus norvegicus) [TaxId:10116] [47558] (1 PDB entry)
  8. 152791Domain d1df0a1: 1df0 A:515-700 [17375]
    Other proteins in same PDB: d1df0a2, d1df0a3, d1df0b_

Details for d1df0a1

PDB Entry: 1df0 (more details), 2.6 Å

PDB Description: crystal structure of m-calpain

SCOP Domain Sequences for d1df0a1:

Sequence, based on SEQRES records: (download)

>d1df0a1 a.39.1.7 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus)}
eieanieeieaneedigdgfrrlfaqlagedaeisafelqtilrrvlakrediksdgfsi
etckimvdmldedgsgklglkefyilwtkiqkyqkiyreidvdrsgtmnsyemrkaleea
gfklpcqlhqvivarfaddeliidfdnfvrclvrleilfkifkqldpentgtiqldlisw
lsfsvl

Sequence, based on observed residues (ATOM records): (download)

>d1df0a1 a.39.1.7 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus)}
eieanieeianeedigdgfrrlfaqlagedaeisafelqtilrrvlakksdgfsietcki
mvdmldedgsgklglkefyilwtkiqkyqkiyreidvdrsgtmnsyemrkaleeagfklp
cqlhqvivarfaddeliidfdnfvrclvrleilfkifkqldpentgtiqldliswlsfsv
l

SCOP Domain Coordinates for d1df0a1:

Click to download the PDB-style file with coordinates for d1df0a1.
(The format of our PDB-style files is described here.)

Timeline for d1df0a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1df0b_