Lineage for d3d7va_ (3d7v A:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955193Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1955265Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1955266Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1955371Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (3 species)
  7. 1955374Species Mouse (Mus musculus) [TaxId:10090] [118213] (5 PDB entries)
    Uniprot P97287 152-308
  8. 1955375Domain d3d7va_: 3d7v A: [173748]
    automated match to d1wsxa_
    complexed with zn

Details for d3d7va_

PDB Entry: 3d7v (more details), 2.03 Å

PDB Description: crystal structure of mcl-1 in complex with an mcl-1 selective bh3 ligand
PDB Compounds: (A:) Induced myeloid leukemia cell differentiation protein Mcl-1

SCOPe Domain Sequences for d3d7va_:

Sequence, based on SEQRES records: (download)

>d3d7va_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]}
ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm
lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
esitdvlvrtkrdwlvkqrgwdgfveffhve

Sequence, based on observed residues (ATOM records): (download)

>d3d7va_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]}
ddlyrqsleiisrylreqatgskdgaagrraletlrrvgdgvqrnhetafqgmlrkldik
neddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaesitdvl
vrtkrdwlvkqrgwdgfveffhve

SCOPe Domain Coordinates for d3d7va_:

Click to download the PDB-style file with coordinates for d3d7va_.
(The format of our PDB-style files is described here.)

Timeline for d3d7va_: