| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.77: RL5-like [55281] (1 superfamily) beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654 |
Superfamily d.77.1: RL5-like [55282] (3 families) ![]() |
| Family d.77.1.0: automated matches [191541] (1 protein) not a true family |
| Protein automated matches [190927] (3 species) not a true protein |
| Species Pyrococcus horikoshii [TaxId:53953] [188693] (1 PDB entry) |
| Domain d3d7ab_: 3d7a B: [173741] automated match to d2pzza1 |
PDB Entry: 3d7a (more details), 1.9 Å
SCOPe Domain Sequences for d3d7ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d7ab_ d.77.1.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
feeveveayvyptedirkvkkamlnlipglqfeafdkgeyvilvgrtkdkralqrlyelf
rgqqildtarmmleegyfgeeiiikvhkqvayvgkvnfnedsplgpititirtkepqklm
kwlaprtkdgvpie
Timeline for d3d7ab_: