Lineage for d3d7ab_ (3d7a B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958441Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 2958442Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 2958556Family d.77.1.0: automated matches [191541] (1 protein)
    not a true family
  6. 2958557Protein automated matches [190927] (3 species)
    not a true protein
  7. 2958564Species Pyrococcus horikoshii [TaxId:53953] [188693] (1 PDB entry)
  8. 2958566Domain d3d7ab_: 3d7a B: [173741]
    automated match to d2pzza1

Details for d3d7ab_

PDB Entry: 3d7a (more details), 1.9 Å

PDB Description: crystal structure of duf54 family protein ph1010 from hyperthermophilic archaea pyrococcus horikoshii ot3
PDB Compounds: (B:) UPF0201 protein PH1010

SCOPe Domain Sequences for d3d7ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d7ab_ d.77.1.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
feeveveayvyptedirkvkkamlnlipglqfeafdkgeyvilvgrtkdkralqrlyelf
rgqqildtarmmleegyfgeeiiikvhkqvayvgkvnfnedsplgpititirtkepqklm
kwlaprtkdgvpie

SCOPe Domain Coordinates for d3d7ab_:

Click to download the PDB-style file with coordinates for d3d7ab_.
(The format of our PDB-style files is described here.)

Timeline for d3d7ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3d7aa_