SCOPe 2.08: Domain d3d7aa_: 3d7a A:

Lineage for d3d7aa_ (3d7a A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.77: RL5-like [55281] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654

4. Superfamily d.77.1: RL5-like [55282] (3 families)

5. Family d.77.1.0: automated matches [191541] (1 protein)
   not a true family

6. Protein automated matches [190927] (3 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [188693] (1 PDB entry)

8. Domain d3d7aa_: 3d7a A: [173740]
   automated match to d2pzza1

Details for d3d7aa_

PDB Entry: 3d7a, 1.9 Å

PDB Description: crystal structure of duf54 family protein ph1010 from hyperthermophilic archaea pyrococcus horikoshii ot3

PDB Compounds: (A:) UPF0201 protein PH1010

SCOPe Domain Sequences for d3d7aa_:

Sequence; same for both SEQRES and ATOM records:

>d3d7aa_ d.77.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mtmfeeveveayvyptedirkvkkamlnlipglqfeafdkgeyvilvgrtkdkralqrly
elfrgqqildtarmmleegyfgeeiiikvhkqvayvgkvnfnedsplgpititirtkepq
klmkwlaprtkdgvpie

Timeline for d3d7aa_:

• d3d7aa_ first appeared in SCOPe 2.01
  
• d3d7aa_ appears in SCOPe 2.07