SCOPe 2.03: Domain d3d78a_: 3d78 A:

Lineage for d3d78a_ (3d78 A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein automated matches [190345] (3 species)
   not a true protein

7. Species Honeybee (Apis mellifera) [TaxId:7460] [188890] (6 PDB entries)

8. Domain d3d78a_: 3d78 A: [173738]
   automated match to d1r5ra_
   complexed with edo, nbb; mutant

Details for d3d78a_

PDB Entry: 3d78, 1.6 Å

PDB Description: dimeric crystal structure of a pheromone binding protein mutant d35n, from apis mellifera, at ph 7.0

PDB Compounds: (A:) Pheromone-binding protein ASP1

SCOPe Domain Sequences for d3d78a_:

Sequence; same for both SEQRES and ATOM records:

>d3d78a_ a.39.2.1 (A:) automated matches {Honeybee (Apis mellifera) [TaxId: 7460]}
apdwvppevfdlvaedkarcmsehgttqaqiddvnkgnlvnepsitcymyclleafslvd
deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi

Timeline for d3d78a_:

• d3d78a_ first appeared in SCOPe 2.01
  
• d3d78a_ appears in SCOPe 2.02
  
• d3d78a_ appears in SCOPe 2.04
  
• d3d78a_ appears in the current release, SCOPe 2.08