Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins) automatically mapped to Pfam PF01395 |
Protein automated matches [190345] (4 species) not a true protein |
Species Honeybee (Apis mellifera) [TaxId:7460] [188890] (6 PDB entries) |
Domain d3d75a_: 3d75 A: [173735] automated match to d1r5ra_ complexed with nbb; mutant |
PDB Entry: 3d75 (more details), 2.3 Å
SCOPe Domain Sequences for d3d75a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d75a_ a.39.2.1 (A:) automated matches {Honeybee (Apis mellifera) [TaxId: 7460]} dwvppevfdlvaedkarcmsehgttqaqiddvnkgnlvnepsitcymyclleafslvdde anvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi
Timeline for d3d75a_: