Lineage for d1alwb_ (1alw B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47807Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)
  6. 47819Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 47822Species Pig (Sus scrofa) [TaxId:9823] [47555] (2 PDB entries)
  8. 47826Domain d1alwb_: 1alw B: [17373]

Details for d1alwb_

PDB Entry: 1alw (more details), 2.03 Å

PDB Description: inhibitor and calcium bound domain vi of porcine calpain

SCOP Domain Sequences for d1alwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1alwb_ a.39.1.7 (B:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa)}
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir
rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

SCOP Domain Coordinates for d1alwb_:

Click to download the PDB-style file with coordinates for d1alwb_.
(The format of our PDB-style files is described here.)

Timeline for d1alwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1alwa_