Lineage for d3d6va1 (3d6v A:2-306)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860046Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2860283Protein automated matches [190581] (10 species)
    not a true protein
  7. 2860301Species Methanocaldococcus jannaschii [TaxId:2190] [188187] (8 PDB entries)
  8. 2860306Domain d3d6va1: 3d6v A:2-306 [173724]
    Other proteins in same PDB: d3d6va2
    automated match to d1j1ua_
    complexed with bme, tfq

Details for d3d6va1

PDB Entry: 3d6v (more details), 2.2 Å

PDB Description: crystal structure of 4-(trifluoromethyldiazirinyl)phenylalanyl-trna synthetase
PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d3d6va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d6va1 c.26.1.1 (A:2-306) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
defemikrntseiiseeelrevlkkdeksaiigfepsgkihlghylqikkmidlqnagfd
iiilladlfaylnqkgeldeirkigdynkkvfeamglkakyvygssfmldkdytlnvyrl
alkttlkrarrsmeliaredenpkvaeviypimqvnplhyegvdvavggmeqrkihmlar
ellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpi
meiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilep
irkrl

SCOPe Domain Coordinates for d3d6va1:

Click to download the PDB-style file with coordinates for d3d6va1.
(The format of our PDB-style files is described here.)

Timeline for d3d6va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d6va2