Lineage for d3d6qb_ (3d6q B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535185Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2535186Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2535187Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2535659Protein automated matches [190061] (7 species)
    not a true protein
  7. 2535662Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)
  8. 2535682Domain d3d6qb_: 3d6q B: [173722]
    automated match to d1a2wa_
    complexed with flc, u3s

Details for d3d6qb_

PDB Entry: 3d6q (more details), 1.6 Å

PDB Description: The RNase A- 5'-Deoxy-5'-N-piperidinouridine complex
PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d3d6qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d6qb_ d.5.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d3d6qb_:

Click to download the PDB-style file with coordinates for d3d6qb_.
(The format of our PDB-style files is described here.)

Timeline for d3d6qb_: