Lineage for d1alwa_ (1alw A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3451Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (7 proteins)
  6. 3460Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 3463Species Pig (Sus scrofa) [TaxId:9823] [47555] (2 PDB entries)
  8. 3466Domain d1alwa_: 1alw A: [17372]

Details for d1alwa_

PDB Entry: 1alw (more details), 2.03 Å

PDB Description: inhibitor and calcium bound domain vi of porcine calpain

SCOP Domain Sequences for d1alwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1alwa_ a.39.1.7 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa)}
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir
rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

SCOP Domain Coordinates for d1alwa_:

Click to download the PDB-style file with coordinates for d1alwa_.
(The format of our PDB-style files is described here.)

Timeline for d1alwa_: