Lineage for d3d6ea_ (3d6e A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042910Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 protein domains)
    Pfam PF00722
    beta-Glucanase-like
  6. 2042987Protein automated matches [191047] (8 species)
    not a true protein
  7. 2042988Species Bacillus licheniformis [TaxId:1402] [188889] (1 PDB entry)
  8. 2042989Domain d3d6ea_: 3d6e A: [173715]
    automated match to d1gbga_
    complexed with ca

Details for d3d6ea_

PDB Entry: 3d6e (more details), 2.4 Å

PDB Description: Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis
PDB Compounds: (A:) Beta-glucanase

SCOPe Domain Sequences for d3d6ea_:

Sequence, based on SEQRES records: (download)

>d3d6ea_ b.29.1.2 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
qtggsfyepfnnyntglwqkwafdhvsmtslgemrlsltspsynkfdgggnqsvqtygyg
lyevnmkpaknvgivsafytstgptdgtpwdeidieflgkdttkvqfnyytngvgnheki
vnlgfdaansyhtyafdwqpnsikwyvdgqlkhtattqipqtpgkiymslwagagvdewl
gsyngvtplyahynwvrytkr

Sequence, based on observed residues (ATOM records): (download)

>d3d6ea_ b.29.1.2 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
qtggsfyepfnnyntglwqkwafdhvsmtslgemrlsltspsynkfdgggnqsvqtygyg
lyevnmkpaknvgivsafytstgptdgtpwdeidieflgkdttkvqfnyytngvgnheki
vnlgfdaansyhtyafdwqpnsikwyvdgqlkhtattqipqtpgkiymslwalyahynwv
rytkr

SCOPe Domain Coordinates for d3d6ea_:

Click to download the PDB-style file with coordinates for d3d6ea_.
(The format of our PDB-style files is described here.)

Timeline for d3d6ea_: