Lineage for d3d61a_ (3d61 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074534Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2074544Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2074545Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
    automatically mapped to Pfam PF04616
  6. 2074597Protein automated matches [191033] (1 species)
    not a true protein
  7. 2074598Species Geobacillus stearothermophilus [TaxId:1422] [188852] (5 PDB entries)
  8. 2074603Domain d3d61a_: 3d61 A: [173709]
    automated match to d1wl7a1
    complexed with ca; mutant

Details for d3d61a_

PDB Entry: 3d61 (more details), 1.95 Å

PDB Description: crystal structure analysis of 1,5-alpha-arabinanase catalytic mutant (abnbd147a) complexed to arabinobiose
PDB Compounds: (A:) Intracellular arabinanase

SCOPe Domain Sequences for d3d61a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d61a_ b.67.2.1 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
vhfhpfgnvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenmg
wvfpslpdwykqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnqtldp
rdpdyewkdmgpvihstasdnynaiapnvvfdqegqpwlsfgsfwsgiqliqldtetmkp
aaqaelltiasrgeepnaieapfivcrngyyylfvsfdfccrgiestykiavgrskditg
pyvdkngvsmmqgggtildegndrwigpghcavyfsgvsailvnhaydalkngeptlqir
plywddegwpylsv

SCOPe Domain Coordinates for d3d61a_:

Click to download the PDB-style file with coordinates for d3d61a_.
(The format of our PDB-style files is described here.)

Timeline for d3d61a_: