![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) ![]() |
![]() | Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins) automatically mapped to Pfam PF04616 |
![]() | Protein automated matches [191033] (1 species) not a true protein |
![]() | Species Geobacillus stearothermophilus [TaxId:1422] [188852] (5 PDB entries) |
![]() | Domain d3d5za_: 3d5z A: [173707] automated match to d1wl7a1 complexed with ca; mutant |
PDB Entry: 3d5z (more details), 1.9 Å
SCOPe Domain Sequences for d3d5za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5za_ b.67.2.1 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} vhfhpfggvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenmg wvfpslpdwykqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnqtldp rdpdyewkdmgpvihstasdnynaidpnvvfdqegqpwlsfgsfwsgiqliqldtetmkp aaqaelltiasrgeepnaiaapfivcrngyyylfvsfdfccrgiestykiavgrskditg pyvdkngvsmmqgggtildegndrwigpghcavyfsgvsailvnhaydalkngeptlqir plywddegwpylsv
Timeline for d3d5za_: