SCOPe 2.05: Domain d3d5ya_: 3d5y A:

Lineage for d3d5ya_ (3d5y A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
   automatically mapped to Pfam PF04616

6. Protein automated matches [191033] (1 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [188852] (5 PDB entries)

8. Domain d3d5ya_: 3d5y A: [173706]
   automated match to d1wl7a1
   complexed with ca; mutant

Details for d3d5ya_

PDB Entry: 3d5y, 1.22 Å

PDB Description: high resolution crystal structure of 1,5-alpha-arabinanase catalytic mutant (abnbe201a)

PDB Compounds: (A:) Intracellular arabinanase

SCOPe Domain Sequences for d3d5ya_:

Sequence; same for both SEQRES and ATOM records:

>d3d5ya_ b.67.2.1 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
vhfhpfggvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenmg
wvfpslpdwykqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnqtldp
rdpdyewkdmgpvihstasdnynaidpnvvfdqegqpwlsfgsfwsgiqliqldtetmkp
aaqaelltiasrgeepnaiaapfivcrngyyylfvsfdfccrgiestykiavgrskditg
pyvdkngvsmmqgggtildegndrwigpghcavyfsgvsailvnhaydalkngeptlqir
plywddegwpylsv

Timeline for d3d5ya_:

• d3d5ya_ first appeared in SCOPe 2.01
  
• d3d5ya_ appears in SCOPe 2.04
  
• d3d5ya_ appears in SCOPe 2.06
  
• d3d5ya_ appears in the current release, SCOPe 2.08