Lineage for d3d5ya_ (3d5y A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397987Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2397997Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2397998Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
    automatically mapped to Pfam PF04616
  6. 2398050Protein automated matches [191033] (2 species)
    not a true protein
  7. 2398051Species Geobacillus stearothermophilus [TaxId:1422] [188852] (5 PDB entries)
  8. 2398053Domain d3d5ya_: 3d5y A: [173706]
    automated match to d1wl7a1
    complexed with ca; mutant

Details for d3d5ya_

PDB Entry: 3d5y (more details), 1.22 Å

PDB Description: High resolution crystal structure of 1,5-alpha-arabinanase catalytic mutant (AbnBE201A)
PDB Compounds: (A:) Intracellular arabinanase

SCOPe Domain Sequences for d3d5ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5ya_ b.67.2.1 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
vhfhpfggvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenmg
wvfpslpdwykqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnqtldp
rdpdyewkdmgpvihstasdnynaidpnvvfdqegqpwlsfgsfwsgiqliqldtetmkp
aaqaelltiasrgeepnaiaapfivcrngyyylfvsfdfccrgiestykiavgrskditg
pyvdkngvsmmqgggtildegndrwigpghcavyfsgvsailvnhaydalkngeptlqir
plywddegwpylsv

SCOPe Domain Coordinates for d3d5ya_:

Click to download the PDB-style file with coordinates for d3d5ya_.
(The format of our PDB-style files is described here.)

Timeline for d3d5ya_: