SCOPe 2.06: Domain d3d5ja1: 3d5j A:1-109

Lineage for d3d5ja1 (3d5j A:1-109)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187694] (13 PDB entries)

8. Domain d3d5ja1: 3d5j A:1-109 [173697]
   Other proteins in same PDB: d3d5ja2
   automated match to d1ktea_
   complexed with gsh; mutant

Details for d3d5ja1

PDB Entry: 3d5j, 1.91 Å

PDB Description: structure of yeast grx2-c30s mutant with glutathionyl mixed disulfide

PDB Compounds: (A:) Glutaredoxin-2, mitochondrial

SCOPe Domain Sequences for d3d5ja1:

Sequence; same for both SEQRES and ATOM records:

>d3d5ja1 c.47.1.0 (A:1-109) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvsqetvahvkdligqkevfvaaktycpyskatlstlfqelnvpkskalvleldemsngs
eiqdaleeisgqktvpnvyingkhiggnsdletlkkngklaeilkpvfq

Timeline for d3d5ja1:

• d3d5ja1 first appeared in SCOPe 2.01, called d3d5ja_
  
• d3d5ja1 was called d3d5ja_ in SCOPe 2.05
  
• d3d5ja1 appears in SCOPe 2.07
  
• d3d5ja1 appears in the current release, SCOPe 2.08