Lineage for d3d5ic_ (3d5i C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2923793Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2923794Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2923795Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2923990Protein automated matches [190834] (3 species)
    not a true protein
  7. 2923999Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries)
  8. 2924016Domain d3d5ic_: 3d5i C: [173696]
    automated match to d1py3b_
    complexed with sgp, so4

Details for d3d5ic_

PDB Entry: 3d5i (more details), 2.2 Å

PDB Description: Crystal structure of ribonuclease Sa2 with exo-2',3'-cyclophosphorotioate
PDB Compounds: (C:) Ribonuclease

SCOPe Domain Sequences for d3d5ic_:

Sequence, based on SEQRES records: (download)

>d3d5ic_ d.1.1.2 (C:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
ladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtpgs
ndrgtrrvvtggygeqywspdhyatfqeidprc

Sequence, based on observed residues (ATOM records): (download)

>d3d5ic_ d.1.1.2 (C:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
ladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtpdr
gtrrvvtggygeqywspdhyatfqeidprc

SCOPe Domain Coordinates for d3d5ic_:

Click to download the PDB-style file with coordinates for d3d5ic_.
(The format of our PDB-style files is described here.)

Timeline for d3d5ic_: