Lineage for d3d5ib_ (3d5i B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013084Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 1013085Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 1013086Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 1013277Protein automated matches [190834] (1 species)
    not a true protein
  7. 1013278Species Streptomyces aureofaciens [TaxId:1894] [188142] (7 PDB entries)
  8. 1013288Domain d3d5ib_: 3d5i B: [173695]
    automated match to d1py3b_
    complexed with sgp, so4

Details for d3d5ib_

PDB Entry: 3d5i (more details), 2.2 Å

PDB Description: Crystal structure of ribonuclease Sa2 with exo-2',3'-cyclophosphorotioate
PDB Compounds: (B:) Ribonuclease

SCOPe Domain Sequences for d3d5ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5ib_ d.1.1.2 (B:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
tpgsndrgtrrvvtggygeqywspdhyatfqeidprc

SCOPe Domain Coordinates for d3d5ib_:

Click to download the PDB-style file with coordinates for d3d5ib_.
(The format of our PDB-style files is described here.)

Timeline for d3d5ib_: