Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) |
Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) |
Protein automated matches [190834] (3 species) not a true protein |
Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries) |
Domain d3d5gc_: 3d5g C: [173692] automated match to d1py3b_ complexed with so4 |
PDB Entry: 3d5g (more details), 1.8 Å
SCOPe Domain Sequences for d3d5gc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5gc_ d.1.1.2 (C:) automated matches {Streptomyces aureofaciens [TaxId: 1894]} dpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvt pgsndrgtrrvvtggygeqywspdhyatfqeidprc
Timeline for d3d5gc_: