SCOP 1.73: Domain d1df0b_: 1df0 B:

Lineage for d1df0b_ (1df0 B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins)

6. Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47554] (6 PDB entries)

8. Domain d1df0b_: 1df0 B: [17369]
   Other proteins in same PDB: d1df0a1, d1df0a2, d1df0a3
   mutant

Details for d1df0b_

PDB Entry: 1df0, 2.6 Å

PDB Description: crystal structure of m-calpain

PDB Compounds: (B:) calpain

SCOP Domain Sequences for d1df0b_:

Sequence; same for both SEQRES and ATOM records:

>d1df0b_ a.39.1.8 (B:) Calpain small (regulatory) subunit (domain VI) {Rat (Rattus norvegicus) [TaxId: 10116]}
neseeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmd
sdttgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysm
iirrysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys

Timeline for d1df0b_:

• d1df0b_ first appeared (with stable ids) in SCOP 1.55
  
• d1df0b_ appears in SCOP 1.71
  
• d1df0b_ appears in SCOP 1.75
  
• d1df0b_ appears in the current release, SCOPe 2.08